DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG17571

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:273 Identity:90/273 - (32%)
Similarity:139/273 - (50%) Gaps:38/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RLALFYTATFLLA----GASGED---GKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYW 66
            ||.|...|...||    |..|.|   |:||||.......:|:.||::..| |.|.||.:|::...
  Fly     3 RLLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTK-GSHFCGGSLIDSET 66

  Fly    67 VLTAAHCVRGSSPEQLDLQYGSQMLARNS-SQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVA 130
            |||||||::..:..:|.::.||  .:|:| .:|..|.|...|.||..: ..:||:|:::|:..|.
  Fly    67 VLTAAHCMQSYAASELQVRVGS--TSRSSGGEVVTVRAFKYHEGYNSK-LMINDVAIIKLSSPVR 128

  Fly   131 LSKFVQPVRLPEPRQVTPGNASAVLAGWGLNA--------TGGVVQQHLQKVKLQVFSDTECSER 187
            .:..::.:.|.:...|:..|  ||::|||...        |       ||||::.:....:|:..
  Fly   129 QTSKIRAIELADSEAVSGTN--AVVSGWGTTCFLFCSSPDT-------LQKVEVDLLHYKDCAAD 184

  Fly   188 HQTYLHDS----QICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEV 248
            ...|..||    .:||...:  |..|.||||||  |:..:..||:|||. ..||...:|||:.:|
  Fly   185 TYNYGSDSILETMVCATGEK--KDACQGDSGGP--LVADNKLVGVVSWG-SGCAWTGYPGVYADV 244

  Fly   249 SAYVDWIVETVNS 261
            ::...|||:|.:|
  Fly   245 ASLRSWIVDTTDS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 75/238 (32%)
Tryp_SPc 30..258 CDD:238113 78/240 (33%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 75/238 (32%)
Tryp_SPc 31..254 CDD:238113 78/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.