DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and KLK3

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:246 Identity:88/246 - (35%)
Similarity:123/246 - (50%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQML-- 91
            :||.|........|:.|.:  |..||..||..|::|.||||||||:|..|.    :..|...|  
Human    24 RIVGGWECEKHSQPWQVLV--ASRGRAVCGGVLVHPQWVLTAAHCIRNKSV----ILLGRHSLFH 82

  Fly    92 ARNSSQVARVAAIFVHPGYE----------PEDKYVNDIALLQLAQSVALSKFVQPVRLP--EPR 144
            ..::.||.:|:..|.||.|:          |.|...:|:.||:|::...|:..|:.:.||  ||.
Human    83 PEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPA 147

  Fly   145 QVTPGNASAVLAGWG-LNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQ 208
            ..|...||    ||| :.....:..:.||.|.|.|.|:..|::.|...:....:|||...|||..
Human   148 LGTTCYAS----GWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKST 208

  Fly   209 CSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETV 259
            |||||||||:..|  ...||.||..:|||.|..|.::|:|..|..||.:|:
Human   209 CSGDSGGPLVCNG--VLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 85/240 (35%)
Tryp_SPc 30..258 CDD:238113 87/242 (36%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 87/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.