DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Send2

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:265 Identity:84/265 - (31%)
Similarity:131/265 - (49%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVMAWLARLALFYTATFLLAG-ASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNP 64
            |.:.::|..|||    ..|.|| ....:.:|:.|...|..|.|:.||::|  .|:|.||.::.:.
  Fly     1 MFIQSFLLLLAL----NSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQR--DGKHLCGGSIYSA 59

  Fly    65 YWVLTAAHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSV 129
            ..::||||||:|   :...::.||.:...|.| |..||||..|.|..      ||||:::|::.:
  Fly    60 DIIITAAHCVQG---QGYQVRAGSALKNSNGS-VVDVAAIRTHEGLG------NDIAIVRLSKPL 114

  Fly   130 ALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQH---LQKVKLQVFSDTECSERHQTY 191
            ..:..|||:  |..:...|..:.|.::|||.::    ...|   ||.|.|.:.....|.     .
  Fly   115 EFTNQVQPI--PLAKTNPPPGSIAFVSGWGSSS----YYSHPIDLQGVNLYIQWPYYCG-----L 168

  Fly   192 LHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQ-VGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            ...|:||||  ..|:..|.|||||||:.   |.| ||:||...|.|.   :..::|.|..:.:||
  Fly   169 TEPSRICAG--SFGRAACKGDSGGPLVF---DQQLVGVVSGGTKDCT---YSSIYTSVPYFREWI 225

  Fly   256 VETVN 260
            :..::
  Fly   226 LNAID 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/229 (32%)
Tryp_SPc 30..258 CDD:238113 76/231 (33%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 74/229 (32%)
Tryp_SPc 27..225 CDD:238113 74/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.