DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and PRSS38

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:272 Identity:94/272 - (34%)
Similarity:138/272 - (50%) Gaps:19/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCV-RGSSPEQLDLQ 85
            |....:|||:.|..|...::|:.||:..|  |.|.||.::||.||||:||||. |..:.:..|:.
Human    52 GRPSMEGKILGGVPAPERKWPWQVSVHYA--GLHVCGGSILNEYWVLSAAHCFHRDKNIKIYDMY 114

  Fly    86 YG--SQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTP 148
            .|  :..:|.|.:|...|..:.:||.||.......|:||:||...:..|:.|.||.|..| :|..
Human   115 VGLVNLRVAGNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLPVCLATP-EVNL 178

  Fly   149 GNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECS--ERHQTYLHDSQICAGLPEGGKGQCSG 211
            .:|:....||||.:..|.....||:::|.:..:..|.  ..|.:|:....:|||.....|..|.|
Human   179 TSANCWATGWGLVSKQGETSDELQEMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAKTVCEG 243

  Fly   212 DSGGPLL--LIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYSPPSSLWVGQLI 274
            ||||||:  ...|..|:|||||. :.|:.|.:|||:..||.:..||.:.:.....|:     |..
Human   244 DSGGPLVCEFNRSWLQIGIVSWG-RGCSNPLYPGVYASVSYFSKWICDNIEITPTPA-----QPA 302

  Fly   275 VGRSP---PSLS 283
            ...||   |:||
Human   303 PALSPALGPTLS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 83/232 (36%)
Tryp_SPc 30..258 CDD:238113 84/234 (36%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 84/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.