DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and PRSS53

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:355 Identity:94/355 - (26%)
Similarity:145/355 - (40%) Gaps:95/355 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAWL-ARLALFYTATFLLAG------ASGEDG----KIVNGTTAGPGEFPFVVSLRRAKSGRHSC 57
            |.|. ..:.|...||.|:.|      |.|:.|    |...|.|. |||:|:..|:||  .|.|.|
Human     1 MKWCWGPVLLIAGATVLMEGLQAAQRACGQRGPGPPKPQEGNTV-PGEWPWQASVRR--QGAHIC 62

  Fly    58 GATLLNPYWVLTAAHCVRGSSPEQLD---LQYGS---QMLARNSSQVARVAAIFVHPGYEPEDKY 116
            ..:|:...||||||||...::..:|:   :..||   :.|:..:.:|. |||:.:...|....: 
Human    63 SGSLVADTWVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEVG-VAALQLPRAYNHYSQ- 125

  Fly   117 VNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQH----------- 170
            .:|:||||||.....:    |:.||:|....|..||....||..:.:.|.....           
Human   126 GSDLALLQLAHPTTHT----PLCLPQPAHRFPFGASCWATGWDQDTSDGKCWPRLKLGEALCLPS 186

  Fly   171 ----------------------------------LQKVKLQVFSDTEC----SERHQTYLHD--- 194
                                              |:.::|::.|...|    ::.||.:|.:   
Human   187 VTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPAR 251

  Fly   195 -SQICAGLPEGGKGQCSGDSGGPLLLIGSD---TQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
             ..:|.|...|.:|.|.||||||:|.:..|   .|.||:|:: ..||:...|.:.|..:|:..|:
Human   252 PGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFA-SSCAQEDAPVLLTNTAAHSSWL 315

  Fly   256 VETVNSYSPPSSLWVGQLIVGRSP--PSLS 283
            ...|.          |...:.:||  |.:|
Human   316 QARVQ----------GAAFLAQSPETPEMS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 77/287 (27%)
Tryp_SPc 30..258 CDD:238113 77/289 (27%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 76/283 (27%)
Tryp_SPc 43..314 CDD:214473 75/280 (27%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.