DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG31954

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:236 Identity:84/236 - (35%)
Similarity:130/236 - (55%) Gaps:15/236 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQML 91
            ||:||.|......:.|..|||   ::..|.||.::::..|:||||||..|.:.::|.::.|:...
  Fly    48 DGRIVGGHRINITDAPHQVSL---QTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEF 109

  Fly    92 ARNSSQVARVAAIFVHPGYEPEDKYVN---DIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASA 153
            || |.|:.||..|..|..:    .|.|   |.:|||||..:...:..:.|:|||.:.......:.
  Fly   110 AR-SGQLLRVQKIVQHAQF----NYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEAC 169

  Fly   154 VLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTY--LHDSQICAGLPEGGKGQCSGDSGGP 216
            .::|||........::.|::|::.:.:...|||:::.|  :.:..||||..||||..|.||||||
  Fly   170 FVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGP 234

  Fly   217 LLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVE 257
             ::..|...||:|||.. .||:|.:|||::.||...|||.|
  Fly   235 -MVSESGELVGVVSWGY-GCAKPDYPGVYSRVSFARDWIKE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 79/230 (34%)
Tryp_SPc 30..258 CDD:238113 82/233 (35%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 79/230 (34%)
Tryp_SPc 51..274 CDD:238113 82/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.