DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG4271

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:244 Identity:77/244 - (31%)
Similarity:117/244 - (47%) Gaps:24/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLD 83
            |:..|...:| |.||..|....:.|:.|:  ..||.|.||..:::...|||||.||:....:::.
  Fly     9 LILFARSSNG-IYNGVEAKFDFWTFLASV--WVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRIT 70

  Fly    84 LQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQ---SVALSKFVQPVRLPEPRQ 145
            ::.|:..:.| ..::.||.|:.||..|:..|   ||||||.|.:   ||.::|.  |:...||.:
  Fly    71 VRVGTPDIYR-GGRIIRVTALVVHENYKNWD---NDIALLWLEKPVLSVRVTKI--PLATKEPSE 129

  Fly   146 -VTPGNASAVLAGWGLNATGG-VVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQ 208
             ..|.|     ||||...... ||.:.||....::...:.|:|.....:.:..:||...|  ...
  Fly   130 NEYPSN-----AGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEELVEPVGEELLCAFYTE--NDI 187

  Fly   209 CSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVE 257
            |.||.||||:|  ::..|||.... ..|.....|.::|.|..|::||.|
  Fly   188 CPGDYGGPLVL--ANKVVGIAVQG-HGCGFAVLPSLYTNVFHYLEWIEE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 71/230 (31%)
Tryp_SPc 30..258 CDD:238113 74/233 (32%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 74/233 (32%)
Tryp_SPc 19..231 CDD:214473 71/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.