DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG1304

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:262 Identity:86/262 - (32%)
Similarity:130/262 - (49%) Gaps:31/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALFYTATFLLA------GASGE-DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVL 68
            |.....:|||.      .|.|. :|::|.|..|...:||..||||.|  |.||||.::|:..:||
  Fly     6 AAILLGSFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNA--GSHSCGGSILSRNYVL 68

  Fly    69 TAAHCV-----RGSS----PEQLDLQYGSQMLARNSSQV-ARVAAIFVHPGYEPEDKYVNDIALL 123
            ||||||     .|:|    .|:..::.||.  .|.|..| .:||.:.||..|   ..::||:|||
  Fly    69 TAAHCVTNQDSNGNSVPIAAERFTIRAGSN--DRFSGGVLVQVAEVIVHEEY---GNFLNDVALL 128

  Fly   124 QLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERH 188
            :|...:.||..:||:.||...  ||.:...:::|||.....|.:.::||...|:..|...|.|..
  Fly   129 RLESPLILSASIQPIDLPTAD--TPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELI 191

  Fly   189 QTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVD 253
            ...: .|::|. :.|...|.|:||||||  .:.::..||:..:....|. ..:|..:..|..:.:
  Fly   192 GWGV-QSELCL-IHEADNGACNGDSGGP--AVYNNQVVGVAGFVWSACG-TSYPDGYARVYYHNE 251

  Fly   254 WI 255
            ||
  Fly   252 WI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 77/235 (33%)
Tryp_SPc 30..258 CDD:238113 79/236 (33%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 77/235 (33%)
Tryp_SPc 32..256 CDD:238113 79/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0U
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.