DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Ser6

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:256 Identity:82/256 - (32%)
Similarity:129/256 - (50%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TFLL------AGASGE-DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCV 74
            :|||      ..|.|: :|::|.|..|...:||..||||.|  |.||||.::|...::|||||||
  Fly    12 SFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNA--GSHSCGGSILTRTYILTAAHCV 74

  Fly    75 RGS---------SPEQLDLQYGSQMLARNSSQV-ARVAAIFVHPGYEPEDKYVNDIALLQLAQSV 129
            ...         :.|:..::.||.  .|.|..| .:||.:.||..|   ..::||:|||:|...:
  Fly    75 SNEDVNHVITPIAAERFTIRAGSN--DRFSGGVLVQVAEVIVHEEY---GNFLNDVALLRLESPL 134

  Fly   130 ALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHD 194
            .||..:||:.||...  ||.:...|::|||.....|.:.::||...|:..:..:|.|... :..:
  Fly   135 ILSASIQPIDLPTVD--TPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELID-FGFE 196

  Fly   195 SQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            .::|. |.:...|.|:||||||  .:.::..||:..:.:..|. ..:|..:..|..:.|||
  Fly   197 GELCL-LHQVDNGACNGDSGGP--AVYNNQLVGVAGFVVDGCG-STYPDGYARVFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/235 (31%)
Tryp_SPc 30..258 CDD:238113 76/236 (32%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 74/235 (31%)
Tryp_SPc 32..256 CDD:238113 76/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.