DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG9672

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:268 Identity:74/268 - (27%)
Similarity:114/268 - (42%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RLALFYTATFLLAGA--SGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAA 71
            :|.|......:.||.  :...|:|..|..|..|:.|:..:|  :..|.::|||.::...:.|||.
  Fly     2 KLTLTIGLILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAAL--SIGGSYNCGAVIIGQRYALTAL 64

  Fly    72 HCVRGSSPE-------------QLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALL 123
            .||.....:             .:||..|.|:         ||..|.::|.|   ......||||
  Fly    65 SCVCSDGKDTPWAAVLFAVTVGSVDLYNGKQI---------RVEEITINPNY---STLKTGIALL 117

  Fly   124 QLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQH--LQKVKLQVFSDTEC-- 184
            :|.:.:..|:.|..:  |..:.|.|..:...::||| ..|...|..|  ||....:|.:..||  
  Fly   118 RLQEEITFSETVNAI--PLSQDVPPMGSQVEVSGWG-RTTESEVNMHRTLQIGAAEVMAPRECAL 179

  Fly   185 SERHQTYLHDSQI-CAGLPEGGK-GQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTE 247
            :.|.:..:.|.|: |.|  .|.: |.||||.|||.:..|.  .||:.:..:..|. ...|..|..
  Fly   180 ANRDELLVADDQVLCLG--HGRRQGICSGDIGGPAVYQGQ--LVGLGAQILGECG-GMLPERFIS 239

  Fly   248 VSAYVDWI 255
            ::|..|||
  Fly   240 IAANYDWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 67/244 (27%)
Tryp_SPc 30..258 CDD:238113 69/245 (28%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 67/244 (27%)
Tryp_SPc 25..250 CDD:238113 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.