DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG9673

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:253 Identity:75/253 - (29%)
Similarity:122/253 - (48%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVR--GSSP-- 79
            :|:..:...|:|:.|.....||:|:..|:|..|:  |.|...:::...:|||||||.  |.:|  
  Fly    18 ILSAEASPQGRILGGEDVAQGEYPWSASVRYNKA--HVCSGAIISTNHILTAAHCVSSVGITPVD 80

  Fly    80 -EQLDLQYGS-QMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLP- 141
             ..|.::.|: ...|..|  :..|.::.:||.|   ..:::|||:|:|.:::..|..:|.:.|| 
  Fly    81 ASTLAVRLGTINQYAGGS--IVNVKSVIIHPSY---GNFLHDIAILELDETLVFSDRIQDIALPP 140

  Fly   142 ----EPRQV---TPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICA 199
                |...|   .|......:|||| ..:.|......||......|.:.| |....|.::|.:|.
  Fly   141 TTDEETEDVDAELPNGTPVYVAGWG-ELSDGTASYKQQKANYNTLSRSLC-EWEAGYGYESVVCL 203

  Fly   200 GLPEGGKGQCSGDSGGPLLLIGSDTQV--GIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            ...| |:|.|.||:|..::   .|.:|  |:.|::..||. ..:|.|.|.||.|:.||
  Fly   204 SRAE-GEGICRGDAGAAVI---DDDKVLRGLTSFNFGPCG-SKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 71/241 (29%)
Tryp_SPc 30..258 CDD:238113 73/242 (30%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 71/241 (29%)
Tryp_SPc 29..259 CDD:238113 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.