DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG9676

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:258 Identity:82/258 - (31%)
Similarity:134/258 - (51%) Gaps:27/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FYTATFLLAGA-------SGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTA 70
            |:|:..:|..|       |..:.:||.||.|..|:||..:||||  .|.|:||.::::..:|:||
  Fly     4 FWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRR--RGSHTCGGSIISKDYVVTA 66

  Fly    71 AHCVRGSS----PEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVAL 131
            ||||:..:    ..:|::|.||.:|:....:|. ||.:.|||.|....   :|:|:|:|..|:..
  Fly    67 AHCVKQGNNVAPANELEIQAGSLLLSSGGVRVP-VATVTVHPNYNSNG---HDVAVLRLRNSLTF 127

  Fly   132 SKFVQPVRL--PEPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHD 194
            :..:..::|  .:|    |.:|:..::|||..:..|.:...|..|:::..|...|.:.:...|.:
  Fly   128 NSNIAAIKLATEDP----PNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPE 188

  Fly   195 SQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVE 257
            :.:|...|: .||.|.||||||....|.  .||:.|:.|..|.|.. |..:..||...:||.|
  Fly   189 TTMCLLHPK-DKGACYGDSGGPATYQGK--LVGLASFVIGGCGRAA-PDGYERVSKLRNWIAE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/231 (32%)
Tryp_SPc 30..258 CDD:238113 77/234 (33%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 74/231 (32%)
Tryp_SPc 28..248 CDD:238113 77/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.