DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG33159

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:260 Identity:91/260 - (35%)
Similarity:133/260 - (51%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVMAWLARLALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPY 65
            :.::.||..||       |:..:|....:||.|......|.|::|.||  ::|...||.:|::..
  Fly     4 LRLLWWLCHLA-------LVLPSSSSKTRIVGGKETTISEVPYLVYLR--QNGYFICGGSLISSR 59

  Fly    66 WVLTAAHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVA 130
            .||:|||||.||.||...:..|:..|.:.:..|..|......|.|...: :..|:|||||.:.|.
  Fly    60 AVLSAAHCVYGSQPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATN-FDMDVALLQLQEVVV 123

  Fly   131 LS----KFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVK---LQVFSDTECSERH 188
            |:    ..:.|.|.|     ..|||.|.::|||:.....  ::..::|:   ::|....||...:
  Fly   124 LTPGKVATISPCRNP-----PEGNAYARISGWGVTRENN--REPAEQVRTTMVRVLPGAECKISY 181

  Fly   189 QTY--LHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQV-GIVSWSIKPCARPPFPGVFTEVSA 250
            ..|  |.||.:||.: .|.:..|||||||||:..|   || |||||.. .||||.||||:|.|::
  Fly   182 SGYGQLSDSMLCAAV-RGLRDSCSGDSGGPLVYRG---QVCGIVSWGF-GCARPSFPGVYTNVAS 241

  Fly   251  250
              Fly   242  241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 85/232 (37%)
Tryp_SPc 30..258 CDD:238113 85/231 (37%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 85/230 (37%)
Tryp_SPc 26..251 CDD:238113 85/231 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.