DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG32523

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:265 Identity:78/265 - (29%)
Similarity:116/265 - (43%) Gaps:25/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WLARLALFYTATFLLA-------GASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLN 63
            |...|.|......:|.       ..|..:.:||.|..|..|:||..:|||  ..|.|.||..:::
  Fly     6 WTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLR--LRGEHYCGGVIIS 68

  Fly    64 PYWVLTAAHCVRGSS---PEQL-DLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQ 124
            ...|:||.|||:..:   |..| .:|.||.:|:.:..::. ||.:.:||.|.....  ||:|:|:
  Fly    69 ATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIP-VAEVIMHPNYATGGH--NDLAVLR 130

  Fly   125 LAQSVALSKFVQPVRLPEPRQVTPGNASAV-LAGWGLNATGGVVQQHLQKVKLQVFSDTECSERH 188
            |...:.....:..::|...   .|.|..|| ::|||..|..|.:...|..|::...|...|....
  Fly   131 LQSPLTFDANIAAIQLATE---DPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMF 192

  Fly   189 QTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSI-KPCARPPFPGVFTEVSAYV 252
            .:.|.::.||. |.....|.|.||||||....|.  .||:.|..: ..|.|.. |..:..:|...
  Fly   193 YSRLPETMICL-LHSKNSGACYGDSGGPATYGGK--VVGLASLLLGGGCGRAA-PDGYLRISKVR 253

  Fly   253 DWIVE 257
            .||.|
  Fly   254 AWIAE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 70/231 (30%)
Tryp_SPc 30..258 CDD:238113 73/234 (31%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/231 (30%)
Tryp_SPc 37..219 CDD:238113 60/190 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.