DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CG32376

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:240 Identity:79/240 - (32%)
Similarity:120/240 - (50%) Gaps:19/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR 93
            :||||......|.||..||.  ..|...||..::|..|:|||.||..| .||:..::.||....|
  Fly    65 RIVNGKRIPCTEAPFQGSLH--YEGYFVCGCVIINKIWILTAHHCFFG-PPEKYTVRVGSDQQRR 126

  Fly    94 NSS--QVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLA 156
            ...  .|.::.|:..:..|...    :|:|:::|...|...|.|:||:||..: .|......|::
  Fly   127 GGQLRHVKKIVALAAYNDYTMR----HDLAMMKLKSPVYFGKCVRPVKLPSTK-TTKFPKKFVVS 186

  Fly   157 GWGL-NATGGVVQQHLQKVKLQVFSDTECSERHQ---TYLHDSQICAGLPEGGKGQCSGDSGGPL 217
            |||: :|....||::|::|::.....::|.:.::   ..::...|||.  ...|..|||||||||
  Fly   187 GWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICAS--RTNKDSCSGDSGGPL 249

  Fly   218 LLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSY 262
            ...|  ...|||||.| .||...:|||:.....||.||.:.::.|
  Fly   250 TSRG--VLYGIVSWGI-GCANKNYPGVYVNCKRYVPWIKKVIHKY 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 76/231 (33%)
Tryp_SPc 30..258 CDD:238113 78/233 (33%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 76/231 (33%)
Tryp_SPc 66..287 CDD:238113 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.