DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk15

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:260 Identity:91/260 - (35%)
Similarity:137/260 - (52%) Gaps:27/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLLAGASGEDG-KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQ 81
            |:|..::.:|| |::.|....|...|:.|:|  .:.||.:|||.|::|.||||||||    ....
Mouse     7 FVLLVSAAQDGDKVLEGEECVPHSQPWQVAL--FERGRFNCGAFLISPRWVLTAAHC----QTRF 65

  Fly    82 LDLQYGSQMLAR--NSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPR 144
            :.::.|...|.:  ...|:..|:.|..|||||.. .:.:||.||:|.:...|:.:|:||.|  ||
Mouse    66 MRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEAR-THRHDIMLLRLFKPARLTAYVRPVAL--PR 127

  Fly   145 QVTPGNASAVLAGWGL------NATGGVVQQH------LQKVKLQVFSDTECSERHQTYLHDSQI 197
            :........|::||||      .|||. .:.|      |....:.:.|:..|::.:...:..:.:
Mouse   128 RCPLIGEDCVVSGWGLLSDNNPGATGS-QKSHVRLPDTLHCANISIISEASCNKDYPGRVLPTMV 191

  Fly   198 CAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSY 262
            |||:..||...|.|||||||:..|:  ..|||||...||.....|||:|:|.:|::||.|.|..|
Mouse   192 CAGVEGGGTDSCEGDSGGPLVCGGA--LQGIVSWGDVPCDTTTKPGVYTKVCSYLEWIWENVRRY 254

  Fly   263  262
            Mouse   255  254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 82/239 (34%)
Tryp_SPc 30..258 CDD:238113 83/241 (34%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 81/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.