DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Prtn3

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:253 Identity:84/253 - (33%)
Similarity:124/253 - (49%) Gaps:22/253 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LAG----ASGEDGKIVNGTTAGPGEFPFVVSLRRAKS-GRHSCGATLLNPYWVLTAAHCVRGSSP 79
            |||    .:.:..|||.|..|.|...|:|.||:.::| |.|.||.||::|.:|||||||::..|.
  Rat   184 LAGVRFHGAVQASKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQDISW 248

  Fly    80 EQLDLQYGSQML--ARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPE 142
            :.:.:..|:..|  :....|...:..:|.: .|.||:. :||:.||||.:..:|.|.|....||:
  Rat   249 QLVTVVLGAHDLLSSEPEQQKFTITQVFEN-NYNPEET-LNDVLLLQLNRPASLGKQVAVASLPQ 311

  Fly   143 PRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYL-HDSQICAGLPEGGK 206
            ..|........:..|||...|.....:.|.::.:.|.          |:| .:..:|..:|....
  Rat   312 QDQSLSQGTQCLAMGWGRLGTRAPTPRVLHELNVTVV----------TFLCREHNVCTLVPRRAA 366

  Fly   207 GQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYSP 264
            |.|.|||||||:..|  ...|:.|:.|:.||...||..|..||.||:||...:.|..|
  Rat   367 GICFGDSGGPLICNG--ILHGVDSFVIRECASLQFPDFFARVSMYVNWIHSVLRSAEP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 77/229 (34%)
Tryp_SPc 30..258 CDD:238113 78/231 (34%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 78/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.