DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Prss30

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:252 Identity:102/252 - (40%)
Similarity:135/252 - (53%) Gaps:22/252 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGS-SPEQLD 83
            :.|.|.:.||||.|..|..|::|:.|||...:.| |.||.:|::..||||||||.|.| :|....
Mouse    64 VCGHSRDAGKIVGGQDALEGQWPWQVSLWITEDG-HICGGSLIHEVWVLTAAHCFRRSLNPSFYH 127

  Fly    84 LQYGS---QMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPR- 144
            ::.|.   .:|..:|:.|| |..|||||.|...|....||||:||...:..|:|. ||.||..: 
Mouse   128 VKVGGLTLSLLEPHSTLVA-VRNIFVHPTYLWADASSGDIALVQLDTPLRPSQFT-PVCLPAAQT 190

  Fly   145 QVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQT---------YLHDSQICAG 200
            .:|||....| .|||......:... ||::.:.:....:|.:.:.|         .:....:|||
Mouse   191 PLTPGTVCWV-TGWGATQERDMASV-LQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAG 253

  Fly   201 LPEGGKGQCSGDSGGPLL--LIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            ..||.|..|.|||||||:  :..|.|||||.||.| .||||..|||:|.|..|||||
Mouse   254 YVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGI-GCARPYRPGVYTRVPTYVDWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 97/241 (40%)
Tryp_SPc 30..258 CDD:238113 98/242 (40%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 98/242 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.