DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk12

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:247 Identity:85/247 - (34%)
Similarity:116/247 - (46%) Gaps:28/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LAGASGED-GKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHC-----VR--G 76
            :.|.|..| .||.||........|:.|.|...|..|  ||..|::..||||||||     ||  .
  Rat    11 VVGLSQADREKIYNGVECVKNSQPWQVGLFHGKYLR--CGGVLVDRKWVLTAAHCSGKYMVRLGE 73

  Fly    77 SSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYE-PEDKYVNDIALLQLAQSVALSKFVQPVRL 140
            .|..:|||          :.|:........||.|. ....:.:|:.||:|.:.::|:..|:||.|
  Rat    74 HSLSKLDL----------TEQLRLTTFSITHPSYHGAYQNHEHDLRLLRLNRPISLTYAVRPVAL 128

  Fly   141 PEPRQVTPGNASAVLAGWG-LNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEG 204
            |.  ...|..|...::||| .|.........||.:.|.:.|:..|.......:.::.:||| .|.
  Rat   129 PS--SCAPTGAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSNETCRAVFPGRVTENMLCAG-GEA 190

  Fly   205 GKGQCSGDSGGPLLLIGSDTQVGIVSW-SIKPCARPPFPGVFTEVSAYVDWI 255
            ||..|.|||||||:..|  ...|:||| |:.||.:...|||:|:|..|.|||
  Rat   191 GKDACQGDSGGPLVCGG--VLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 80/235 (34%)
Tryp_SPc 30..258 CDD:238113 81/236 (34%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 80/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.