DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk14

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:268 Identity:96/268 - (35%)
Similarity:133/268 - (49%) Gaps:19/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VMAWL--ARLALFYTATFLLAGA---SGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLL 62
            :..|.  :|:.|..|....||.|   |..|.||:.|.|......|:.|:|:.....|..||..||
  Rat    52 LQTWTSGSRMLLLLTILQALAVAIVQSQGDDKILGGYTCVQNSQPWQVALQAGPGRRFLCGGVLL 116

  Fly    63 NPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR--NSSQVARVAAIFVHPGYEPEDKYVNDIALLQL 125
            :..||:|||||.|    ..|.:..|...|.|  .:.||.||.....||.|.|: .:.||:.||:|
  Rat   117 SDQWVITAAHCAR----PLLHVALGKHNLRRWEATQQVLRVVRQVPHPQYRPQ-AHDNDLMLLKL 176

  Fly   126 AQSVALSKFVQPVRLPEPRQ-VTPGNASAVLAGWGLNATGGV-VQQHLQKVKLQVFSDTECSERH 188
            .:.|.|.:.|:.:  |..|. .:||....| :|||..|:..| ....||.|.:.:..:..|...:
  Rat   177 QRKVRLGRAVRTI--PVARSCASPGTPCRV-SGWGTTASPIVRYPTALQCVNVNIMPEQVCHRAY 238

  Fly   189 QTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVD 253
            ...:....:|||:|||||..|.|||||||:..|.  ..|:|||.::.||.|.:|||:|.:..|..
  Rat   239 PGTITSGMVCAGVPEGGKDSCQGDSGGPLVCQGQ--LQGLVSWGMERCAMPGYPGVYTNLCNYHS 301

  Fly   254 WIVETVNS 261
            ||..|:.|
  Rat   302 WIQRTMQS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 83/229 (36%)
Tryp_SPc 30..258 CDD:238113 84/231 (36%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 84/231 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341122
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.