DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and GZMM

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_005308.2 Gene:GZMM / 3004 HGNCID:4712 Length:257 Species:Homo sapiens


Alignment Length:250 Identity:85/250 - (34%)
Similarity:120/250 - (48%) Gaps:12/250 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVR 75
            :|...|...|:..|....:|:.|....|...|::.||:|  :|.|.||..|::|.||||||||: 
Human     7 SLLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQR--NGSHLCGGVLVHPKWVLTAAHCL- 68

  Fly    76 GSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRL 140
            .....||.|..|...| .:......:.|...||.|:|.....||:|||||...|..|:.::|:.|
Human    69 AQRMAQLRLVLGLHTL-DSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLAL 132

  Fly   141 PEPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERH--QTYLHDSQICAGLPE 203
            |..|||........:|||||...||.:.:.|:::.|||.....|:...  ...|..|.:|.....
Human   133 PSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADS 197

  Fly   204 GGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCA---RPPFPGVFTEVSAYVDWI 255
            ..:..|.|||||||:.........::|:|.:.|.   :||   |.|.|:.||.||
Human   198 KDQAPCKGDSGGPLVCGKGRVLARVLSFSSRVCTDIFKPP---VATAVAPYVSWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 79/230 (34%)
Tryp_SPc 30..258 CDD:238113 80/230 (35%)
GZMMNP_005308.2 Tryp_SPc 26..252 CDD:238113 80/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6163
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.