DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and GZMH

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_219491.1 Gene:GZMH / 2999 HGNCID:4710 Length:246 Species:Homo sapiens


Alignment Length:249 Identity:90/249 - (36%)
Similarity:131/249 - (52%) Gaps:22/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLLAGASGEDGKIVNGTTAGPGEFPFV--VSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPE 80
            |||...:|.: :|:.|..|.|...|::  |...:.|| |..||..|:...:||||||| :|||  
Human    10 FLLTPGAGTE-EIIGGHEAKPHSRPYMAFVQFLQEKS-RKRCGGILVRKDFVLTAAHC-QGSS-- 69

  Fly    81 QLDLQYGSQML--ARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEP 143
             :::..|:..:  ...:.|...|.....||.|.|:: :.|||.||||.:....:..|:|:|||..
Human    70 -INVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKN-FSNDIMLLQLERKAKWTTAVRPLRLPSS 132

  Fly   144 R-QVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSER--HQTYLHDSQICAGLPEGG 205
            : ||.||...:| ||||. .:...:...||:|.|.|..|.:| ||  |..|...::||.|.|:..
Human   133 KAQVKPGQLCSV-AGWGY-VSMSTLATTLQEVLLTVQKDCQC-ERLFHGNYSRATEICVGDPKKT 194

  Fly   206 KGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETV 259
            :....||||||  |:..|...||:|:..|. ..|  |||:.:||.::.||..|:
Human   195 QTGFKGDSGGP--LVCKDVAQGILSYGNKK-GTP--PGVYIKVSHFLPWIKRTM 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 83/232 (36%)
Tryp_SPc 30..258 CDD:238113 85/234 (36%)
GZMHNP_219491.1 Tryp_SPc 21..242 CDD:238113 85/234 (36%)
Mediates the preference for acidic residues at the P3' and P4' sites 46..48 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.