DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Elane

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:255 Identity:82/255 - (32%)
Similarity:124/255 - (48%) Gaps:18/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCV 74
            ||....|..|:..|...:  ||.|..|.|..:||:|||:|  .|.|.|||||:...:|::|||||
  Rat    15 LASMLLALLLVCPALASE--IVGGRPAQPHAWPFMVSLQR--RGGHFCGATLIARNFVMSAAHCV 75

  Fly    75 RGSSPEQLDLQYGSQMLARN--SSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQP 137
            .|.:.:.:.:..|:..|.|.  :.|:..|..||.: |::| .:.:|||.::||..|..::..||.
  Rat    76 NGRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFEN-GFDP-SRLLNDIVIIQLNGSATINANVQV 138

  Fly   138 VRLPEPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLP 202
            ..||...|........|..|||...|...:...||::.:.|.::. |..|       ..:|..:|
  Rat   139 AELPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVVTNL-CRRR-------VNVCTLVP 195

  Fly   203 EGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSY 262
            ....|.|.||||||  |:.::...||.|:....|....:|..|..|:.:.|||...:.|:
  Rat   196 RRQAGICFGDSGGP--LVCNNLVQGIDSFIRGGCGSGFYPDAFAPVAEFADWINSIIRSH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/227 (33%)
Tryp_SPc 30..258 CDD:238113 76/229 (33%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 74/229 (32%)
Tryp_SPc 33..249 CDD:238113 76/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.