DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk1c3

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:266 Identity:80/266 - (30%)
Similarity:125/266 - (46%) Gaps:28/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WLARLALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTA 70
            |...|.|..:...:.|...|: .::|.|........|:.|    |......||..|::|.||:||
  Rat     2 WFLILFLALSLGQIDAAPPGQ-SRVVGGFKCEKNSQPWQV----AVINEDLCGGVLIDPSWVITA 61

  Fly    71 AHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEP---------EDKYVNDIALLQLA 126
            |||.    .:...:..|...|:.: .|...|:..|.||.|:|         ...|.||:.||.|:
  Rat    62 AHCY----SDNYHVLLGQNNLSED-VQHRLVSQSFRHPDYKPFLMRNHTRKPKDYSNDLMLLHLS 121

  Fly   127 QSVALSKFVQPVRLP--EPRQVTPGNASAVLAGWG-LNATGGVVQQHLQKVKLQVFSDTECSERH 188
            :...::..|:.:.||  ||:.    .::.:::||| .|.:.......||.|.:.:.|:.:|.:.:
  Rat   122 EPADITDGVKVIDLPTKEPKV----GSTCLVSGWGSTNPSEWEFPDDLQCVNIHLLSNEKCIKAY 182

  Fly   189 QTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVD 253
            :..:.|..:|||..||||..|.|||||||:..|  ...||.||...||..|..||::|::..:..
  Rat   183 KEKVTDLMLCAGELEGGKDTCRGDSGGPLICDG--VLQGITSWGSVPCGEPNKPGIYTKLIKFTS 245

  Fly   254 WIVETV 259
            ||.|.:
  Rat   246 WIKEVM 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 72/237 (30%)
Tryp_SPc 30..258 CDD:238113 74/239 (31%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 72/237 (30%)
Tryp_SPc 25..250 CDD:238113 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.