DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk1c8

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001013085.2 Gene:Klk1c8 / 292866 RGDID:1305359 Length:261 Species:Rattus norvegicus


Alignment Length:270 Identity:79/270 - (29%)
Similarity:123/270 - (45%) Gaps:38/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WLARLALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTA 70
            ||..|.|..:..:..|...|: .:|:.|........|:.|::......:  ||..|::|.||:||
  Rat     2 WLLILFLILSLGWNDAAPPGQ-SRIIGGFNCEKNSQPWQVAVYHFNEPQ--CGGVLIHPSWVITA 63

  Fly    71 AHCVRGSSPEQLDLQYGSQMLARNS-------SQVARVAAIFVHPGY----------EPEDKYVN 118
            |||        ..:.| ...|.||:       :|...|:..|.|||:          :|.:.|.|
  Rat    64 AHC--------YSVNY-QVWLGRNNLLEDEPFAQHRLVSQSFPHPGFNLDIIKNHTRKPGNDYSN 119

  Fly   119 DIALLQLAQSVALSKFVQPVRLP--EPRQVTPGNASAVLAGWG-LNATGGVVQQHLQKVKLQVFS 180
            |:.||.|.....::..|:.:.||  ||:.    .::.:.:||| :..........||.|.:.:.|
  Rat   120 DLMLLHLKTPADITDGVKVIDLPTEEPKV----GSTCLTSGWGSITPLKWEFPDDLQCVNIHLLS 180

  Fly   181 DTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVF 245
            :.:|.:.:...:.|..:|||..:|||..|.|||||||:..|  ...||.||...||..|..|.|:
  Rat   181 NEKCIKAYNDEVTDVMLCAGEMDGGKDICKGDSGGPLICDG--VLQGITSWGSMPCGEPNKPSVY 243

  Fly   246 TEVSAYVDWI 255
            |::..:..||
  Rat   244 TKLIKFTSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 71/245 (29%)
Tryp_SPc 30..258 CDD:238113 73/246 (30%)
Klk1c8NP_001013085.2 Tryp_SPc 24..253 CDD:214473 71/245 (29%)
Tryp_SPc 25..256 CDD:238113 73/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.