DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk1c10

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001128645.1 Gene:Klk1c10 / 292858 RGDID:1561403 Length:259 Species:Rattus norvegicus


Alignment Length:277 Identity:84/277 - (30%)
Similarity:127/277 - (45%) Gaps:51/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFYTATFLLAGASGED------GKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTA 70
            :::...||.....|.|      .:||.|........|:.|::    ...:.||..|::|.||:||
  Rat     1 MWFLILFLALSLGGIDAAPPGQSRIVGGYKCEKNSQPWQVAI----INEYLCGGVLIDPSWVITA 61

  Fly    71 AHCVRGSSPEQLDLQYGSQMLARNS-------SQVARVAAIFVHPGYEP----------EDKYVN 118
            |||..         .|...:|.||:       :|...|...|.||.|:|          .|.|.|
  Rat    62 AHCYS---------NYYHVLLGRNNLFEDEPFAQYRFVNQSFPHPDYKPFLMRNHTRQRGDDYSN 117

  Fly   119 DIALLQLAQSVALSKFVQPVRLP--EPRQVTPGNASAVLAGWG----LNATGGVVQQHLQKVKLQ 177
            |:.||.|::...::..|:.:.||  ||:.    .::.:.:|||    ||   ..:...||.|.:.
  Rat   118 DLMLLHLSEPADITDGVKVIDLPTEEPKV----GSTCLASGWGSTKPLN---WELPDDLQCVNIH 175

  Fly   178 VFSDTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFP 242
            :.|:.:|.|.::..:.|..:|||..:|.|..|.|||||||:..|  ...||.||...|||.|..|
  Rat   176 LLSNEKCIEAYEQKVTDLMLCAGEMDGRKDTCKGDSGGPLICDG--VLQGITSWGNVPCAEPYNP 238

  Fly   243 GVFTEVSAYVDWIVETV 259
            ||:|::..:..||.|.:
  Rat   239 GVYTKLIKFTSWIKEVM 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 77/248 (31%)
Tryp_SPc 30..258 CDD:238113 79/250 (32%)
Klk1c10NP_001128645.1 Tryp_SPc 24..251 CDD:214473 77/248 (31%)
Tryp_SPc 25..254 CDD:238113 79/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.