DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk7

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:261 Identity:91/261 - (34%)
Similarity:136/261 - (52%) Gaps:20/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WLARLALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTA 70
            ||  |:|......|....:|:..:|::|.....|..|:.|:|  .|..:..||..|:...|||||
  Rat     4 WL--LSLLTVLLSLALETAGQGERIIDGYKCKEGSHPWQVAL--LKGDQLHCGGVLVGESWVLTA 64

  Fly    71 AHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFV 135
            |||..|    |..:..||..:...|:|..:.:..|.||||... .:||||.|:::.:.|.:|..|
  Rat    65 AHCKMG----QYTVHLGSDKIEDQSAQRIKASRSFRHPGYSTR-THVNDIMLVKMDKPVKMSDKV 124

  Fly   136 QPVRLP---EPRQVTPGNASAVLAGWGLNATGGVV-QQHLQKVKLQVFSDTECSERHQTYLHDSQ 196
            |.|:||   ||    ||....| :|||...:..|. ...|....:::.|..||.:.::..|..:.
  Rat   125 QKVKLPDHCEP----PGTLCTV-SGWGTTTSPDVTFPSDLMCSDVKLISSQECKKVYKDLLGKTM 184

  Fly   197 ICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNS 261
            :|||:|:.....|:||||||  |:.:||..|:|||...||.:|..|||:|:|..|..|:.:|:.:
  Rat   185 LCAGIPDSKTNTCNGDSGGP--LVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYQRWLEDTMKT 247

  Fly   262 Y 262
            |
  Rat   248 Y 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 82/229 (36%)
Tryp_SPc 30..258 CDD:238113 83/231 (36%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 82/228 (36%)
Tryp_SPc 26..244 CDD:238113 83/231 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.