DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk9

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:280 Identity:95/280 - (33%)
Similarity:132/280 - (47%) Gaps:44/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RLALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHC 73
            :|.|......||||..|.|.:.|..........|:...|....  |..|||||:|..|:||||||
  Rat     2 KLGLTLVLFSLLAGHCGADTRAVGARECQRNSQPWQAGLFYLT--RQLCGATLINDQWLLTAAHC 64

  Fly    74 ------VR--------GSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPE---DKYVNDIA 121
                  ||        ...||:|.|                |...|.|||:.|:   :.:.:||.
  Rat    65 RKPYLWVRLGEHHLWQWEGPEKLLL----------------VTDFFPHPGFNPDLSANDHNDDIM 113

  Fly   122 LLQLAQSVALSKFVQPVRLPEPRQVTPG-NASAVLAGWGLNATGGVVQ--QHLQKVKLQVFSDTE 183
            |::|.:.|.||..|||:.|   .|..|. ....:::||| :.:...:|  ..||...:.:..:..
  Rat   114 LIRLPRKVRLSPAVQPLNL---SQSLPSVGTQCLISGWG-SVSSSKIQFPMTLQCANISILDNKL 174

  Fly   184 CSERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEV 248
            |...:..::.:..:||||.|||:|.|.|||||||:..|  |..||||...:||:||..|.|:|.|
  Rat   175 CRWAYPGHISEKMLCAGLWEGGRGSCQGDSGGPLVCKG--TLAGIVSGGSEPCSRPQRPAVYTSV 237

  Fly   249 SAYVDWIVETVNSYSPPSSL 268
            ..|:|||..||..|:..:.|
  Rat   238 FHYLDWIENTVEKYNHTNKL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 81/245 (33%)
Tryp_SPc 30..258 CDD:238113 83/247 (34%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 83/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.