DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk13

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:257 Identity:90/257 - (35%)
Similarity:126/257 - (49%) Gaps:17/257 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLD 83
            :|.|.:|..|.:..|.|..|...|:..:|  ...||..||..|::|.||||||||.:    :...
  Rat    26 ILNGTNGTSGFLPGGYTCLPHSQPWQAAL--LVRGRLLCGGVLVHPKWVLTAAHCRK----DGYT 84

  Fly    84 LQYGSQMLAR--NSSQVARVAAIFVHPGYEPEDKYVN---DIALLQLAQSVALSKFVQPVRLPEP 143
            :..|...|.|  |..|...|.....||.|:....::|   ||.||:|...|.||..|:.::|...
  Rat    85 VHLGKHALGRVENGEQAMEVVRSIPHPEYQVSPTHLNHDHDIMLLELKSPVQLSNHVRTLQLSAD 149

  Fly   144 RQVTPGNASAVLAGWGLNATGGV-VQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKG 207
            ..:..|....| :|||...:..| ..:.||...:::.||.||.:.:...:..:.:|||..||||.
  Rat   150 DCLPTGTCCRV-SGWGTTTSPQVNYPKTLQCANIELRSDEECRQVYPGKITANMLCAGTKEGGKD 213

  Fly   208 QCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYSPPSSLW 269
            .|.|||||||:..|.  ..||:||...||.:|..|||:|.||.|:.||..|:.  :.|...|
  Rat   214 SCEGDSGGPLICNGK--LYGIISWGDFPCGQPNRPGVYTRVSKYLRWIQGTIR--NTPEQGW 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 81/231 (35%)
Tryp_SPc 30..258 CDD:238113 83/233 (36%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 83/231 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.