DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Prss54

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_038953481.1 Gene:Prss54 / 291846 RGDID:1307877 Length:384 Species:Rattus norvegicus


Alignment Length:253 Identity:57/253 - (22%)
Similarity:100/253 - (39%) Gaps:52/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLARNSS-QVARVAA 103
            |||:|||: :.|...|.....:|:.:|:|:.|..:: :..|.:.:...:.|..||:. :...:.|
  Rat    42 EFPWVVSI-QDKQYTHLAFGCILSEFWILSTASALQ-NRKEVIAVVGIANMDPRNADHKEYSINA 104

  Fly   104 IFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPV-----RLPEPRQVTPGNASAVLAGW----G 159
            |..|..:. .:...|:||||:...::.....|||:     .|.:|..:    .:..:|||    .
  Rat   105 IIPHENFN-NNSMRNNIALLRTDSAIHFDDLVQPICFLGKSLHKPTAL----KNCWVAGWNPTSA 164

  Fly   160 LNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGGP-------- 216
            :|....:....|:::.:   :|.|....|:   .....||.........|.|:.|.|        
  Rat   165 VNTGNHMTMSILRRISV---NDIEVCPLHR---QQKTECASHTNKDSNVCLGEPGNPMMCQVKKL 223

  Fly   217 -------LLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYSPPSS 267
                   ||..|||...|::              ::|.|..|.:||:.......||.|
  Rat   224 DLWILRGLLAYGSDLCPGLL--------------LYTSVDDYSNWIIAKTRKAGPPLS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 52/239 (22%)
Tryp_SPc 30..258 CDD:238113 54/242 (22%)
Prss54XP_038953481.1 Tryp_SPc 42..255 CDD:419748 52/239 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341137
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.