DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Gzmk

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:263 Identity:86/263 - (32%)
Similarity:121/263 - (46%) Gaps:29/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLLAG--ASGED--GKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCV-RGS 77
            ||:||  .|.|.  .:|:.|....|...||:.|::  ..|:|.||..|::|.||||||||. ||.
  Rat    10 FLVAGIYMSSESFHTEIIGGREVQPHSRPFMASIQ--YRGKHICGGVLIHPQWVLTAAHCYSRGH 72

  Fly    78 SPEQLDLQYGSQMLARNS--SQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRL 140
            ||   .:..|:..|::|.  .|...:.......|::   ...|||.|::|..:..|:|.||.:.|
  Rat    73 SP---TVVLGAHSLSKNEPMKQTFEIKEFIPFSGFK---SGTNDIMLIKLRTAAELNKHVQLLHL 131

  Fly   141 PEPRQVTPGNASAVLAGWGLNATGGV-VQQHLQKVKLQVFSDTECSER----HQTYLHDSQICAG 200
            .....:..|....| .|||......: ....||:|.:.:.|...|:.:    |:..:....||||
  Rat   132 RSKNYIRDGTKCQV-TGWGSTKPDVLTTSDTLQEVTVTIISRKRCNSQSYYNHKPVITKDMICAG 195

  Fly   201 LPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVS-AYVDWIVETVNSYSP 264
            ...|.|..|.|||||||:..|  ....:||...| |.....|||:|.:: .|..||    .|...
  Rat   196 DRRGEKDSCKGDSGGPLICKG--VFHALVSGGYK-CGISNKPGVYTLLTKKYQTWI----KSKLA 253

  Fly   265 PSS 267
            |||
  Rat   254 PSS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/234 (32%)
Tryp_SPc 30..258 CDD:238113 76/236 (32%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 74/234 (32%)
Tryp_SPc 26..251 CDD:238113 76/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.