DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Prss38

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:278 Identity:91/278 - (32%)
Similarity:139/278 - (50%) Gaps:28/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAWLAR---LALFYTATFLLAGASGE---DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLL 62
            :.|..|   |.||      |:.|.|:   .||::.|......::|:.||:..|  |.|.||.::|
  Rat    88 LLWCGREPSLHLF------LSSACGQPALHGKLLGGELTIDRKWPWQVSIHYA--GFHVCGGSIL 144

  Fly    63 NPYWVLTAAHC-VRGSSPEQLDLQYGSQML--ARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQ 124
            |.||||||||| .|....:..|:..|...|  |...:|...:..:.:||.:|.......|:||:|
  Rat   145 NAYWVLTAAHCFAREKRLQTFDMYVGITNLEVANKHTQWFEINQVIIHPTFEMFHPVGGDVALVQ 209

  Fly   125 LAQSVALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERH- 188
            ...::..|.:|.|:.||. ..:...:.|....|||:.:..|...:.|.:.:|.:....:|...: 
  Rat   210 SKSAIVFSDYVLPICLPS-SNLNLSDLSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYG 273

  Fly   189 -QTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDT--QVGIVSWSIKPCARPPFPGVFTEVSA 250
             .:||....:|||..:..|..|.||||.||:...:.|  |:|||||. :.||:|.:||||..||.
  Rat   274 LTSYLLPEMLCAGDIKNMKNVCEGDSGSPLVCKVNQTWLQIGIVSWG-RGCAQPLYPGVFANVSY 337

  Fly   251 YVDWI---VETVNSYSPP 265
            :::||   :||:.  .||
  Rat   338 FLNWIRYNMETIP--DPP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 76/232 (33%)
Tryp_SPc 30..258 CDD:238113 77/237 (32%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 76/230 (33%)
Tryp_SPc 116..342 CDD:214473 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.