DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Prss34

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:297 Identity:104/297 - (35%)
Similarity:145/297 - (48%) Gaps:49/297 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAWLARLALFYT-----ATFLLAGASGED--GKIVNGTTAGPGEFPFVVSLR----RAKSGRHSC 57
            |.|.    ||.|     :|..|...||::  | ||.|.......||:.||||    :.....|.|
  Rat     5 MLWF----LFLTLPCLGSTMPLTPDSGQELVG-IVGGCPVSASRFPWQVSLRFYNMKLSKWEHIC 64

  Fly    58 GATLLNPYWVLTAAHCVRGSSPEQ--LDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVN-- 118
            |.:|::|.|||||||||.....|.  ..:|.|...|..| .|:.:||.|..||.:..:.....  
  Rat    65 GGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRLYEN-DQLMKVAKIIRHPKFSEKLSAPGGA 128

  Fly   119 DIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQ--------HLQKVK 175
            |||||:|..:|.||:.|.||.||...|......:..:|||      ||::.        ||::|.
  Rat   129 DIALLKLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGW------GVIEGHRPLPPPCHLREVA 187

  Fly   176 LQVFSDTECSERHQTY---------LHDSQICAGLPEGGKGQCSGDSGGPLLLIG--SDTQVGIV 229
            :.:..:::|.::::||         :.|..:|||:.  |:..|..||||||:...  |..|||:|
  Rat   188 VPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGME--GRDSCQADSGGPLVCRWNCSWVQVGVV 250

  Fly   230 SWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYSPPS 266
            ||.| .|..|.||||:|.|.:|:.||...|..:..||
  Rat   251 SWGI-GCGLPDFPGVYTRVMSYLSWIHGYVPKFPEPS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 89/252 (35%)
Tryp_SPc 30..258 CDD:238113 91/254 (36%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 90/252 (36%)
Tryp_SPc 33..275 CDD:214473 89/251 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.