DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk7

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:258 Identity:91/258 - (35%)
Similarity:139/258 - (53%) Gaps:14/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WLARLALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTA 70
            ||  |:|......|....:|:..:|::|.....|..|:.|:|  .|..:..||..|::.||||||
Mouse     4 WL--LSLITVLLSLALETAGQGERIIDGYKCKEGSHPWQVAL--LKGNQLHCGGVLVDKYWVLTA 64

  Fly    71 AHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFV 135
            |||..|    |..:|.||..:...|:|..:....|.||||..: .:||||.|::|.:.|.:|..|
Mouse    65 AHCKMG----QYQVQLGSDKIGDQSAQKIKATKSFRHPGYSTK-THVNDIMLVRLDEPVKMSSKV 124

  Fly   136 QPVRLPEPRQVTPGNASAVLAGWGLNATGGVV-QQHLQKVKLQVFSDTECSERHQTYLHDSQICA 199
            :.|:|||  ...|...|..::|||...:..|. ...|....:::.|..||.:.::..|..:.:||
Mouse   125 EAVQLPE--HCEPPGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYKDLLGKTMLCA 187

  Fly   200 GLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSY 262
            |:|:.....|:||||||  |:.:||..|:|||...||.:|..|||:|:|..|..|::||:.::
Mouse   188 GIPDSKTNTCNGDSGGP--LVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETMKTH 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 82/226 (36%)
Tryp_SPc 30..258 CDD:238113 83/228 (36%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 82/226 (36%)
Serine protease. /evidence=ECO:0000250 26..246 85/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837409
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0U
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42512
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.