DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and PRSS54

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:297 Identity:74/297 - (24%)
Similarity:122/297 - (41%) Gaps:67/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LARLALFYTAT-------FLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNP 64
            |..|.|.|::|       .:..|...::|.:      ...|||:||||:.::. .|.....:|:.
Human    18 LVLLGLLYSSTSCGVQKASVFYGPDPKEGLV------SSMEFPWVVSLQDSQY-THLAFGCILSE 75

  Fly    65 YWVLTAAHCVRGSSPEQLDLQYGSQMLARNSSQVAR----VAAIFVHPGYEPEDKYVNDIALLQL 125
            :|||:.|..::    .:.|:.....:...:.|::|.    |..|.:|..:: .:...|:||||:.
Human    76 FWVLSIASAIQ----NRKDIVVIVGISNMDPSKIAHTEYPVNTIIIHEDFD-NNSMSNNIALLKT 135

  Fly   126 AQSVALSKFVQPV-RLPEPRQVTPGNASAVLAGWG-LNATGG-VVQQHLQKV-----------KL 176
            ..::.....||.: .|.......|...:..::||. .:|||. :....|:|:           ||
Human   136 DTAMHFGNLVQSICFLGRMLHTPPVLQNCWVSGWNPTSATGNHMTMSVLRKIFVKDLDMCPLYKL 200

  Fly   177 QVFSDTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLL--LIGSDTQV--GIVSWSIKPCA 237
            |   .|||....:             |..|..|.||.|.|::  |...|..|  |::::..:.| 
Human   201 Q---KTECGSHTK-------------EETKTACLGDPGSPMMCQLQQFDLWVLRGVLNFGGETC- 248

  Fly   238 RPPFPGVF--TEVSAYVDWIVETVNSYSPP-SSL--W 269
                ||:|  |:|..|..||........|| |||  |
Human   249 ----PGLFLYTKVEDYSKWITSKAERAGPPLSSLHHW 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 59/249 (24%)
Tryp_SPc 30..258 CDD:238113 61/251 (24%)
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 59/238 (25%)
Tryp_SPc 52..264 CDD:238113 59/238 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.