DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Tmprss4

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_663378.1 Gene:Tmprss4 / 214523 MGIID:2384877 Length:435 Species:Mus musculus


Alignment Length:246 Identity:90/246 - (36%)
Similarity:135/246 - (54%) Gaps:25/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLD--- 83
            |.|.:..::|.|..|....:|:.||::..|  :|.||.::|:|:|:||||||.|    :.||   
Mouse   195 GKSLKTPRVVGGVEAPVDSWPWQVSIQYNK--QHVCGGSILDPHWILTAAHCFR----KYLDVSS 253

  Fly    84 --LQYGSQMLARNSSQVARVAAIFV---HPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEP 143
              ::.||.:|..:.|  ..||.||:   :|.| |::|   ||||::|...:..|..|:|:.||..
Mouse   254 WKVRAGSNILGNSPS--LPVAKIFIAEPNPLY-PKEK---DIALVKLQMPLTFSGSVRPICLPFS 312

  Fly   144 RQVTPGNASAVLAGWGL-NATGGVVQQHLQKVKLQVFSDTECS--ERHQTYLHDSQICAGLPEGG 205
            .:|........:.|||. ...||.:...|.:..:||...|.|:  :.::..:....:|||.|:||
Mouse   313 DEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGG 377

  Fly   206 KGQCSGDSGGPLLLIGSDTQ-VGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            |..|.|||||||:......| ||||||. ..|..|..|||:|:|:||::||
Mouse   378 KDTCQGDSGGPLMYHSDKWQVVGIVSWG-HGCGGPSTPGVYTKVTAYLNWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 86/237 (36%)
Tryp_SPc 30..258 CDD:238113 88/238 (37%)
Tmprss4NP_663378.1 LDLa 56..90 CDD:238060
SRCR_2 106..195 CDD:295335 90/246 (37%)
Tryp_SPc 202..427 CDD:214473 86/237 (36%)
Tryp_SPc 203..430 CDD:238113 88/238 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.