DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk6

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001158168.1 Gene:Klk6 / 19144 MGIID:1343166 Length:253 Species:Mus musculus


Alignment Length:235 Identity:78/235 - (33%)
Similarity:110/235 - (46%) Gaps:16/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGS 88
            |.|..|:|:|........||..:|  ..||...||..|::|.||||||||.:    ..|.:..|.
Mouse    23 SEEQEKVVHGGPCLKDSHPFQAAL--YTSGHLLCGGVLIDPQWVLTAAHCKK----PNLQVILGK 81

  Fly    89 QMLARNSS---QVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGN 150
            ..|.:..:   |:: |....|||.|.|| .:.|||.::.|...|..||.:||  ||.....:..|
Mouse    82 HNLRQTETFQRQIS-VDRTIVHPRYNPE-THDNDIMMVHLKNPVKFSKKIQP--LPLKNDCSEEN 142

  Fly   151 ASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGG 215
            .:..:.||| ....|.....:|...:.:....:|...:...:..|.:|||..:.|...|.|||||
Mouse   143 PNCQILGWG-KMENGDFPDTIQCADVHLVPREQCERAYPGKITQSMVCAGDMKEGNDSCQGDSGG 206

  Fly   216 PLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            ||:..|  ...|:|||...||.....|||:|:|..::.||
Mouse   207 PLVCGG--RLRGLVSWGDMPCGSKEKPGVYTDVCTHIRWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/228 (32%)
Tryp_SPc 30..258 CDD:238113 75/229 (33%)
Klk6NP_001158168.1 Tryp_SPc 28..244 CDD:214473 74/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.