DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk1b4

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_035045.2 Gene:Klk1b4 / 18048 MGIID:97320 Length:256 Species:Mus musculus


Alignment Length:233 Identity:75/233 - (32%)
Similarity:122/233 - (52%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFV 106
            |:.|::.|  ..::.||..||:..||||||||.  :...|:.|...:.:....|.|...|:....
Mouse    32 PWHVAVYR--FNKYQCGGVLLDRNWVLTAAHCY--NDKYQVWLGKNNFLEDEPSDQHRLVSKAIP 92

  Fly   107 HPGY----------EPEDKYVNDIALLQLAQSVALSKFVQPVRLP--EPRQVTPGNASAVLAGWG 159
            ||.:          :|||.|.||:.||:|::...::..|:|:.||  ||:.    .::.:.:|||
Mouse    93 HPDFNMSLLNEHTPQPEDDYSNDLMLLRLSKPADITDVVKPITLPTEEPKL----GSTCLASGWG 153

  Fly   160 LNATGGVVQQH---LQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIG 221
              :|..:..::   ||.|.|::..:.:|.:.|:..:.|:.:|||..:||...|..||||||:..|
Mouse   154 --STTPIKFKYPDDLQCVNLKLLPNEDCDKAHEMKVTDAMLCAGEMDGGSYTCEHDSGGPLICDG 216

  Fly   222 SDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETV 259
              ...||.||..:||..|..|.|:|::..:..||.||:
Mouse   217 --ILQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETM 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 71/227 (31%)
Tryp_SPc 30..258 CDD:238113 73/230 (32%)
Klk1b4NP_035045.2 Tryp_SPc 13..251 CDD:238113 73/230 (32%)
Activation peptide homolog 18..24
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.