DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Mcpt8

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_032598.1 Gene:Mcpt8 / 17231 MGIID:1261780 Length:247 Species:Mus musculus


Alignment Length:261 Identity:82/261 - (31%)
Similarity:125/261 - (47%) Gaps:21/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFYTATFLLAG--ASGEDGKIVNGTTAGPGEFPFVVSLR-RAKSGRHSCGATLLNPYWVLTAAHC 73
            :|.....|:|.  .:.|.|:|:.||.:.|...|::..:| ......:.||..|:....|:|||||
Mouse     1 MFLLLVLLVAALPVNAEGGEIIWGTESKPHSRPYMAYIRFNDSKSVYRCGGFLVARDIVMTAAHC 65

  Fly    74 VRGSSPEQLDLQYGSQML-ARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQP 137
                :.:.:::..|...| .:.::|:..|:....|..::.| ..||||.||:|.:...|:..|..
Mouse    66 ----NGKVINVTLGIHNLKKKKNTQLIPVSEAIPHESFDNE-TLVNDIMLLKLERKAQLNSAVDT 125

  Fly   138 VRLPEPRQ-VTPGNASAVLAGWG--LNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICA 199
            :.||:.:. |.||....| ||||  .|.|   :...||:|.|:|....:|....|||....|:|.
Mouse   126 IALPKSKDWVKPGQVCTV-AGWGKLANCT---LSDTLQEVNLEVQKGQKCRSMSQTYNDSIQLCV 186

  Fly   200 GLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNSYSP 264
            |.|...|....||||||.:..|  ...||||..:  |. ...|.|||.:|:::.||.:|:.....
Mouse   187 GNPSENKATGKGDSGGPFVCNG--VVQGIVSCRL--CT-GTLPRVFTRISSFMPWIRKTMKLLQQ 246

  Fly   265 P 265
            |
Mouse   247 P 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 73/230 (32%)
Tryp_SPc 30..258 CDD:238113 75/232 (32%)
Mcpt8NP_032598.1 Tryp_SPc 20..237 CDD:214473 73/230 (32%)
Tryp_SPc 21..240 CDD:238113 75/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.