DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Mcpt2

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_032597.1 Gene:Mcpt2 / 17225 MGIID:96938 Length:244 Species:Mus musculus


Alignment Length:258 Identity:81/258 - (31%)
Similarity:126/258 - (48%) Gaps:27/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLR-RAKSG-RHSCGATLLNPYWVLTAAHCV 74
            ||..|..|.:||..|:  |:.|..|.|...|::..|: ..|:| :..||..|:.|.:|:||||| 
Mouse     5 LFLMALLLPSGAGAEE--IIGGVEAKPHSRPYMAYLKFTTKNGSKERCGGFLIAPQFVMTAAHC- 66

  Fly    75 RGSSPEQLDLQYGSQMLARN--SSQVARVAAIFVHPGYEPEDKYVN---DIALLQLAQSVALSKF 134
            .||   ::.:..|:..:.:|  :.|:.:....||||.::    |::   ||.||:|.:...|:..
Mouse    67 NGS---EISVILGAHNINKNEPTQQIIKTEKTFVHPKFQ----YLSGFYDIMLLKLQKKAELNSD 124

  Fly   135 VQPVRLPEPRQ-VTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQIC 198
            |..:.||.... :.||. ....||||.......:...|::|:|::.....|.: |..|.:..|:|
Mouse   125 VDVISLPSSSDFIKPGK-MCWTAGWGKTGKNNPLSVTLREVELRIMDQEACKD-HSDYDYQLQVC 187

  Fly   199 AGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNS 261
            ||.|...|....|||||||:   .|:    |:..|........|.|||.:|.|:.||.:.:.|
Mouse   188 AGSPTTSKSIGQGDSGGPLV---CDS----VAHGIASSYEAKAPAVFTRISYYLPWIYKVLKS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 71/233 (30%)
Tryp_SPc 30..258 CDD:238113 73/235 (31%)
Mcpt2NP_032597.1 Tryp_SPc 20..237 CDD:214473 71/235 (30%)
Tryp_SPc 21..240 CDD:238113 73/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.