DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Gzmc

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_599159.1 Gene:Gzmc / 171290 RGDID:620019 Length:248 Species:Rattus norvegicus


Alignment Length:252 Identity:83/252 - (32%)
Similarity:122/252 - (48%) Gaps:20/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TFLL-AGASGEDGKIVNGTTAGPGEFPFVVSLRRAK-SGRHS-CGATLLNPYWVLTAAHCVRGSS 78
            |.|| .||..|:  |:.|....|...|::....... :|:.: ||..|:...:||||||| ||.|
  Rat     9 TLLLPLGARAEE--IIGGNEVSPHSRPYMAYFEFLNDNGKKTFCGGFLVRDNFVLTAAHC-RGRS 70

  Fly    79 PEQLDLQYGSQML--ARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLP 141
               :.:..|:..:  ...:.|:..||....||.|.| ||..|||.||:|.:|...:..|:|:.||
  Rat    71 ---MTVTLGAHNIKAKEKTQQIIPVANATPHPAYNP-DKRSNDIMLLKLVRSAKRTSAVRPLNLP 131

  Fly   142 EPR-QVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQ-TYLHDSQICAGLPEG 204
            ... .|.||:. ..:||||.....|.....|::|:|.|..|..|..:.| :|:..|:||.|..:.
  Rat   132 RRNAHVKPGDV-CYMAGWGKITPQGEFPNTLREVELTVQKDRVCESQFQRSYIKASEICVGDSKT 195

  Fly   205 GKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNS 261
            .......|||||  |:......||||:.....:.|.   |||.|.:::.||.:|:.:
  Rat   196 KGASFEEDSGGP--LVCKKAAAGIVSYGKTDGSAPQ---VFTRVLSFLSWIKKTMKN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/231 (32%)
Tryp_SPc 30..258 CDD:238113 76/233 (33%)
GzmcNP_599159.1 Tryp_SPc 20..241 CDD:214473 74/233 (32%)
Tryp_SPc 21..244 CDD:238113 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.