DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Gzmm

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_032530.1 Gene:Gzmm / 16904 MGIID:99549 Length:264 Species:Mus musculus


Alignment Length:274 Identity:99/274 - (36%)
Similarity:136/274 - (49%) Gaps:25/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAWLARLALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVL 68
            :.|  .|.|......|.|..:..:.:|:.|..|.|...|::.||::|||  |.||..|::..|||
Mouse     3 VCW--SLLLLLALKTLWAAGNRFETQIIGGREAVPHSRPYMASLQKAKS--HVCGGVLVHRKWVL 63

  Fly    69 TAAHCVRGSSP-EQLDLQYGSQML--ARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVA 130
            |||||:  |.| :.|.|..|...|  .::......:.....||||  ..||.||:|||:|.:.|.
Mouse    64 TAAHCL--SEPLQNLKLVLGLHNLHDLQDPGLTFYIREAIKHPGY--NHKYENDLALLKLDRRVQ 124

  Fly   131 LSKFVQPVRLP-EPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERH--QTYL 192
            .||.|:|:.|| :||...........||||:...||...:.||::.|:|.....|:...  ...|
Mouse   125 PSKNVKPLALPRKPRSKPAEGTWCSTAGWGMTHQGGPRARALQELDLRVLDTQMCNNSRFWNGVL 189

  Fly   193 HDSQICAGLPEGGKGQ--CSGDSGGPLLLIGSDTQVGIVSWSIKPCA---RPPFPGVFTEVSAYV 252
            .||.:|  |..|.|.|  |.|||||| |:.|.....||:|:|.|.|.   :||   |.|.|:.|.
Mouse   190 IDSMLC--LKAGSKSQAPCKGDSGGP-LVCGKGQVDGILSFSSKTCTDIFKPP---VATAVAPYS 248

  Fly   253 DWIVETVNSYSPPS 266
            .||.:.:..:||.|
Mouse   249 SWIRKVIGRWSPQS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 89/236 (38%)
Tryp_SPc 30..258 CDD:238113 91/238 (38%)
GzmmNP_032530.1 Tryp_SPc 27..254 CDD:238113 91/238 (38%)
Tryp_SPc 27..251 CDD:214473 89/235 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6163
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.