DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CFD

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:267 Identity:84/267 - (31%)
Similarity:127/267 - (47%) Gaps:30/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AWLARLALFYTATFLLAGASGED---------GKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGAT 60
            :| .|||:.   ..|.|.|.||:         |:|:.|..|.....|::.|::  .:|.|.||..
Human     3 SW-ERLAVL---VLLGAAACGEEAWAWAAPPRGRILGGREAEAHARPYMASVQ--LNGAHLCGGV 61

  Fly    61 LLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR--NSSQVARVAAIFVHPGYEPEDKYVNDIALL 123
            |:...|||:||||:..::..::.:..|:..|::  .|.::..|.....||..:| |...:|:.||
Human    62 LVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQP-DTIDHDLLLL 125

  Fly   124 QLAQSVALSKFVQPVRLP---EPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECS 185
            ||::...|...|:|  ||   ..|.|.||....| ||||:....|.....||.|.|.|.....|:
Human   126 QLSEKATLGPAVRP--LPWQRVDRDVAPGTLCDV-AGWGIVNHAGRRPDSLQHVLLPVLDRATCN 187

  Fly   186 ER--HQTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEV 248
            .|  |...:.:..:||  ....:..|.|||||||:..|  ...|:|:...:.|.....||::|.|
Human   188 RRTHHDGAITERLMCA--ESNRRDSCKGDSGGPLVCGG--VLEGVVTSGSRVCGNRKKPGIYTRV 248

  Fly   249 SAYVDWI 255
            ::|..||
Human   249 ASYAAWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 72/232 (31%)
Tryp_SPc 30..258 CDD:238113 74/233 (32%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 72/232 (31%)
Tryp_SPc 33..258 CDD:238113 74/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.