DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk1b26

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_034774.1 Gene:Klk1b26 / 16618 MGIID:891981 Length:261 Species:Mus musculus


Alignment Length:246 Identity:76/246 - (30%)
Similarity:122/246 - (49%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR 93
            ::|.|........|:.|::...|  .|.||..||:..||||||||.    .:|.::..|...|.:
Mouse    24 RVVGGFNCEKNSQPWQVAVYYQK--EHICGGVLLDRNWVLTAAHCY----VDQYEVWLGKNKLFQ 82

  Fly    94 N--SSQVARVAAIFVHPGYE----------PEDKYVNDIALLQLAQSVALSKFVQPVRLP--EPR 144
            .  |:|...|:..|.|||:.          |...:.||:.||:|::...::..|:|:.||  ||:
Mouse    83 EEPSAQHRLVSKSFPHPGFNMSLLMLQTTPPGADFSNDLMLLRLSKPADITDVVKPIALPTKEPK 147

  Fly   145 QVTPGNASAVLAGWG-LNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQICAGLPEGGKGQ 208
               || ::.:.:||| :..|.......||.|.:.:..:..|::.:...:.|..:|||...|||..
Mouse   148 ---PG-STCLASGWGSITPTRWQKSDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDT 208

  Fly   209 CSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETV 259
            |:|||||||:..|  ...|..|...:||.:|..|.::|.:..:..||.:|:
Mouse   209 CAGDSGGPLICDG--ILQGTTSNGPEPCGKPGVPAIYTNLIKFNSWIKDTM 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 73/240 (30%)
Tryp_SPc 30..258 CDD:238113 75/242 (31%)
Klk1b26NP_034774.1 Tryp_SPc 24..253 CDD:214473 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837407
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.