DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk1b24

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_034773.1 Gene:Klk1b24 / 16617 MGIID:892021 Length:263 Species:Mus musculus


Alignment Length:272 Identity:87/272 - (31%)
Similarity:137/272 - (50%) Gaps:37/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFYTATFLLAGASGED------GKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTA 70
            :::...||.....|.|      .::|.|........|:.|::.|  ..::.||..||||.|||||
Mouse     1 MWFLILFLALSLGGIDAAPPVQSRVVGGFKCEKNSQPWHVAVFR--YNKYICGGVLLNPNWVLTA 63

  Fly    71 AHCVRGSSPEQLDLQYGSQMLARN--SSQVARVAAIFVHPGY----------EPEDKYVNDIALL 123
            |||. |::..|.::..|...|.:.  |:|...|:..|.||.|          :|:|| .||:.||
Mouse    64 AHCY-GNATSQYNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDDIPQPKDK-SNDLMLL 126

  Fly   124 QLAQSVALSKFVQPVRLP--EPRQVTPGNASAVLAGWG-LNATGGVVQQHLQKVKLQVFSDTECS 185
            :|::...::..|:|:.||  ||:.    .::.:.:||| :..|.......||.|.:::..:..|:
Mouse   127 RLSEPADITDAVKPIDLPTEEPKL----GSTCLASGWGSITPTKWQKPNDLQCVFIKLLPNENCT 187

  Fly   186 ERHQTYLH---DSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTE 247
               :.|||   |..:|||...|||..|:|||||||:..|  ...||.||...||.:|..|.::|:
Mouse   188 ---KPYLHKVTDVMLCAGEMGGGKDTCAGDSGGPLICDG--ILHGITSWGPVPCGKPNAPAIYTK 247

  Fly   248 VSAYVDWIVETV 259
            :..:..||.:|:
Mouse   248 LIKFASWIKDTM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 80/243 (33%)
Tryp_SPc 30..258 CDD:238113 82/245 (33%)
Klk1b24NP_034773.1 Tryp_SPc 24..255 CDD:214473 80/243 (33%)
Tryp_SPc 25..258 CDD:238113 82/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.