DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and CTSG

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_011534801.1 Gene:CTSG / 1511 HGNCID:2532 Length:269 Species:Homo sapiens


Alignment Length:269 Identity:89/269 - (33%)
Similarity:135/269 - (50%) Gaps:26/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LARLALFYTATFLLAGASGED--------GKIVNGTTAGPGEFPFVVSLR-RAKSGRHSCGATLL 62
            |..|..|...|...||::..:        |:|:.|..:.|...|::..|: ::.:|:..||..|:
Human     4 LLLLLAFLLPTGAEAGSASIELSAKCFLPGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLV 68

  Fly    63 NPYWVLTAAHCVRGSSPEQLDLQYGSQMLAR--NSSQVARVAAIFVHPGYEPEDKYVNDIALLQL 125
            ...:||||||| .||:   :::..|:..:.|  |:.|.........||.|. :....|||.||||
Human    69 REDFVLTAAHC-WGSN---INVTLGAHNIQRRENTQQHITARRAIRHPQYN-QRTIQNDIMLLQL 128

  Fly   126 AQSVALSKFVQPVRLPEPRQ-VTPGNASAVLAGWG-LNATGGVVQQHLQKVKLQVFSDTECSERH 188
            ::.|..::.|.||.||..:: :.||....| |||| ::...|.  ..|::|:|:|..|.:|....
Human   129 SRRVRRNRNVNPVALPRAQEGLRPGTLCTV-AGWGRVSMRRGT--DTLREVQLRVQRDRQCLRIF 190

  Fly   189 QTYLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVD 253
            .:|....|||.|.....|....||||||||.  ::...||||:. |....|  |.|||.||:::.
Human   191 GSYDPRRQICVGDRRERKAAFKGDSGGPLLC--NNVAHGIVSYG-KSSGVP--PEVFTRVSSFLP 250

  Fly   254 WIVETVNSY 262
            ||..|:.|:
Human   251 WIRTTMRSF 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 78/230 (34%)
Tryp_SPc 30..258 CDD:238113 80/232 (34%)
CTSGXP_011534801.1 Tryp_SPc 34..252 CDD:214473 78/230 (34%)
Tryp_SPc 35..255 CDD:238113 80/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.