DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Gzmc

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006518631.1 Gene:Gzmc / 14940 MGIID:109256 Length:279 Species:Mus musculus


Alignment Length:249 Identity:81/249 - (32%)
Similarity:122/249 - (48%) Gaps:18/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSG--RHSCGATLLNPYWVLTAAHCVRGSSP 79
            |.||...:|.: :|:.|....|...|::......|.|  :..||..|:...:||||||| :||| 
Mouse    40 TLLLPLRAGAE-EIIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAHC-KGSS- 101

  Fly    80 EQLDLQYGSQML--ARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPE 142
              :.:..|:..:  ...:.|:..||....||.|.|:|: .|||.||:|.::...::.|:|:.||.
Mouse   102 --MTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDR-SNDIMLLKLVRNAKRTRAVRPLNLPR 163

  Fly   143 PR-QVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQ-TYLHDSQICAGLPEGG 205
            .. .|.||: ...:||||.....|...:.|.:|||.|..|..|..:.| :|...::||.|..:..
Mouse   164 RNAHVKPGD-ECYVAGWGKVTPDGEFPKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDSKIK 227

  Fly   206 KGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETV 259
            ......|||||  |:......||||:.....:.|.   |||.|.::|.||.:|:
Mouse   228 GASFEEDSGGP--LVCKRAAAGIVSYGQTDGSAPQ---VFTRVLSFVSWIKKTM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 74/231 (32%)
Tryp_SPc 30..258 CDD:238113 76/233 (33%)
GzmcXP_006518631.1 Tryp_SPc 52..275 CDD:238113 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.