DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and PRSS58

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001001317.1 Gene:PRSS58 / 136541 HGNCID:39125 Length:241 Species:Homo sapiens


Alignment Length:225 Identity:57/225 - (25%)
Similarity:101/225 - (44%) Gaps:18/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLARNSS---QVARVAA 103
            |::|.|   ||....|...|::|.||:|||||    :..:|.:..|..:.|.::.   ||.....
Human    29 PYLVYL---KSDYLPCAGVLIHPLWVITAAHC----NLPKLRVILGVTIPADSNEKHLQVIGYEK 86

  Fly   104 IFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQ 168
            :..||.:. .....:||.|::|.....|:.:|:...|  |.|....|....::.|..|......:
Human    87 MIHHPHFS-VTSIDHDIMLIKLKTEAELNDYVKLANL--PYQTISENTMCSVSTWSYNVCDIYKE 148

  Fly   169 -QHLQKVKLQVFSDTECSERHQTY-LHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSW 231
             ..||.|.:.|.|..:|.:.::|| :.::.:|.|:..|.:..|...|..|.:..|  ...||:|:
Human   149 PDSLQTVNISVISKPQCRDAYKTYNITENMLCVGIVPGRRQPCKEVSAAPAICNG--MLQGILSF 211

  Fly   232 SIKPCARPPFPGVFTEVSAYVDWIVETVNS 261
            : ..|......|::.::..|:.||...:.:
Human   212 A-DGCVLRADVGIYAKIFYYIPWIENVIQN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 55/217 (25%)
Tryp_SPc 30..258 CDD:238113 57/220 (26%)
PRSS58NP_001001317.1 Tryp_SPc 29..234 CDD:214473 55/217 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.