DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Klk1b9

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_034246.1 Gene:Klk1b9 / 13648 MGIID:95293 Length:261 Species:Mus musculus


Alignment Length:264 Identity:88/264 - (33%)
Similarity:129/264 - (48%) Gaps:35/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLLAGASGED------GKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRG 76
            ||.....|.|      .:||.|........|:.|::.|  ...:.||..||:..||||||||.. 
Mouse     7 FLALSLGGIDAAPPVHSRIVGGFKCEKNSQPWHVAVYR--YNEYICGGVLLDANWVLTAAHCYY- 68

  Fly    77 SSPEQLDLQYGSQMLARN--SSQVARVAAIFVHPGY----------EPEDKYVNDIALLQLAQSV 129
               |:..:..|...|...  |:|...|:..|:||||          .||..|.||:.||:|::..
Mouse    69 ---EENKVSLGKNNLYEEEPSAQHRLVSKSFLHPGYNRSLHRNHIRHPEYDYSNDLMLLRLSKPA 130

  Fly   130 ALSKFVQPVRLP--EPRQVTPGNASAVLAGWGLNATGGVVQ--QHLQKVKLQVFSDTECSERHQT 190
            .::..|:|:.||  ||:.    .::.:.:||| :.|....|  :.||.|.|::..:.:|.:.|..
Mouse   131 DITDVVKPIALPTEEPKL----GSTCLASGWG-STTPFKFQNAKDLQCVNLKLLPNEDCGKAHIE 190

  Fly   191 YLHDSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255
            .:.|..:|||..:|||..|.|||||||:..|  ...||.||...||..|..|||:|::..:..||
Mouse   191 KVTDVMLCAGETDGGKDTCKGDSGGPLICDG--VLQGITSWGFTPCGEPKKPGVYTKLIKFTSWI 253

  Fly   256 VETV 259
            .:|:
Mouse   254 KDTM 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 81/241 (34%)
Tryp_SPc 30..258 CDD:238113 83/243 (34%)
Klk1b9NP_034246.1 Tryp_SPc 24..253 CDD:214473 81/241 (34%)
Tryp_SPc 25..256 CDD:238113 83/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837412
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.