DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32808 and Prss1

DIOPT Version :9

Sequence 1:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_444473.1 Gene:Prss1 / 114228 MGIID:98839 Length:246 Species:Mus musculus


Alignment Length:257 Identity:90/257 - (35%)
Similarity:129/257 - (50%) Gaps:24/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALFYTATFLLAGAS-----GEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTA 70
            ||.:.|   |.||:     .:|.|||.|.|......|:.|||   .||.|.||.:|:|..||::|
Mouse     3 ALLFLA---LVGAAVAFPVDDDDKIVGGYTCRENSVPYQVSL---NSGYHFCGGSLINDQWVVSA 61

  Fly    71 AHCVRGSSPEQLDLQYGSQML--ARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSK 133
            |||.:    .::.::.|...:  ...:.|....|.|..||.:. .....|||.|::|:..|.|:.
Mouse    62 AHCYK----TRIQVRLGEHNINVLEGNEQFIDAAKIIKHPNFN-RKTLNNDIMLIKLSSPVTLNA 121

  Fly   134 FVQPVRLPEPRQVTPGNASAVLAGWGLNATGGVVQQH-LQKVKLQVFSDTECSERHQTYLHDSQI 197
            .|..|.||.  ...|.....:::|||...:.||.:.. ||.:...:....:|...:...:..:.:
Mouse   122 RVATVALPS--SCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGKITGNMV 184

  Fly   198 CAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETV 259
            |||..||||..|.||||||::..| :.| |||||.. .||.|..|||:|:|..|||||.:|:
Mouse   185 CAGFLEGGKDSCQGDSGGPVVCNG-ELQ-GIVSWGY-GCALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 80/228 (35%)
Tryp_SPc 30..258 CDD:238113 81/230 (35%)
Prss1NP_444473.1 Tryp_SPc 23..239 CDD:214473 80/228 (35%)
Tryp_SPc 24..242 CDD:238113 81/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.